Komunitné fórum Thunderbird

I am still paying for websites, just to keep my emails going but it sure is expensive with it being personal now. I don't store my emails with the current host, they just play middleman, receive the emails and ship them off to my Thunderbird. I store them on my computer and my external harddrive. Can you tell me how either I can host my own emails or a really reasonable priced email host? I don't want to loose these emails. The ones that mostly got used by the businesses have been dissolved. But the ones we are getting personal emails threw, we want to keep. Please advise.... thank you for your time and dedication to helping. Judi

My Thunderbird messages screen buttons now has a new button named "RWH" and when you click on it, the choices are "Enable for 10s" or "Enable or headers for 10s". I search the Help file for RWH and 10s and found nothing? What is RWH and 10s? What do those two choices do?

A tech person at Tisch school of the arts, New York University, deleted my local folder in my Thunderbird account. He said it posed to Security risk. Is there anyway that my local folder can be restored?

I have been having trouble logging into comcast with Thunderbird for a long time. I often get an error message and the only solution is shutting down Thunderbird and turning off my Norton VPN, then restarting Norton, and then restarting Thunderbird. This usually works. Starting about an hour ago, I can't connect to comcast with Thunderbird no matter what I do. I can access my email on comcast with their software, but I much prefer Thunderbird. Is this a Thunderbird problem or a comcast problem?

Hi all,

This thread was closed, but never answered : https://support.mozilla.org/en-US/questions/1440794

I am STILL having the same issue. However, this time it's with Fedora 40.

If I click ANY mailto link, anywhere, and Thunderbird is already running, then it takes about 10 seconds of inactivity after clicking the link, and I get that error.

It's not usable for any mailto links.

Does anyone have any feedback on things I can try?

Thank you

Best Buy installed a new hard drive with additional storage capacity on my computer. A lot of stuff got wiped out and had to be re-installed, including Thunderbird. Now, Thunderbird is slow to respond to the server and even simple reply messages can take a minute or longer to send. It takes a long time to get messages, send, etc. What can I do to increase speed? My ISP tells me I have 45 MB of speed [soon to be 300mb] and that something is slowing down the email process, not them. Also, when I forward a message Thunderbird sends all the coded info with the messages that confuses the receipient. For example, if I send a political cartoon, some will delete the message because the cartoon is on the very bottom of the message and all the sending material is first and he thinks the message is a gag of some sort. Messages used to just show the sender and receipient(s) names and topic, not all the unnecessary detail involved in the message itself.

Can you please me with these issues, as I am so frustrated that I am exploring using Gmail or Outlook instead.

Thanks. Jim Maciej jvm1@windstream.net

I use multiple VPNs for various reasons. Windows 10, TB v128.2.3esr. When I open TB and leave it opened all day, I change VPNs depending on whether I am working or viewing global sports. When I change VPNs TB doesn't seem to care when collecting my email from our corporate server. However, the calendar alerts me of an appointment but won't allow me to dismiss it nor wait for X time in the future. Any ideas why this is the case? It seem the entire technology industry hates VPNs and many web sites try to block VPN access (I had to cancel my Consumer Reports subscription (40 years) since I could no longer log in using a VPN (a 9 month recent phenomenon)).

I'm boggled by this one. I use Thunderbird 128.2.0esr (64-bit) on Fedora and Gnome. I use it as my mail interface and my POP server is Gmail.

Earlier this week, when I pulled up the list of emails in my inbox, I noticed that emails from GitHub were all "From" one apparently random person. If I click on the email and look at the mail in the preview pane, it too has the incorrect "From" value.

However, if I reply to or forward the email, it will have the correct "From" address.

What's stranger, is I also get emails from Jira and other bots. They two have the same issue but with another person. For instance, all of my emails from GitHub now come from "John Smith". All my Jira emails come from "Elizabeth Doe (Jira)". The people they are coming from are people I receive those types of emails from, but not every single email. I've rebooted, and still the same problem, and still the same wrong people in the From field for GitHub, Jira, and others.

Any ideas?

I am a multi-decade Thunderbird user, and this is a problem new to the most recent release.

I have some large MBOX local folders (to be clear, a single file in the disk directory), and there are never deletions, only additions. Every week or so, there is one local folder (that only gets additions) which TBird takes 15 minutes to try to compact, and fails creating a new local folder (with -1 appended to the name), which has only a portion of the content of the original folder (that original folder appears to be untouched).

I have already upped the compaction threshold to 100MB, but it recurs nonetheless.

Is there any fix to this?

Thanks Jonathan

after replying to an email, I checked the Sent folder and cannot see my reply text only garbage (see reply.jpg) strangely, the reply text is correctly visible (and readable!) on my iPhone (using icloud account in Thunderbird)

PS if that may help, email was replied to before latest update 128.2.3esr

Have been using Thunderbird for a long time with a gmail and an Outlook account. (Outlook recently created problems in Tbird and in both mobile apps that I use and I want to dump it!)

I created a Mailfence account today - the free version. Tried to add the Mailfence account to Tbird. There are posts in this forum saying Mailfence doesn't allow imap / smtp access if you only have the free account, and there are posts saying it's allowed during a 2-week trial. Does anyone know for sure? On the Mailfence site, there seems to be no way to find the necessary settings, and every time I try to set it up (whether automatically or manually) the Mailfence account refuses to connect. So I suspect those who say you have to pay are correct.

I have send several emails to a contact that is returned as not deliverable from postmaster@outlook.com. The notification email shows that the address has been changed for an old email address even though the correct email address is shown in the details. The change appears to have been by outlook.com Correct emails is via slingshot and the old email is outlook.

Details below

Delivery has failed to these recipients or groups:

colinandchris@outlook.com A communication failure occurred during the delivery of this message. Please try to resend the message later. If the problem continues, contact your email admin.

Diagnostic information for administrators:

Generating server: MW4PR18MB5184.namprd18.prod.outlook.com

colinandchris@outlook.com Remote server returned '550 5.5.0 Requested action not taken: mailbox unavailable.'

Original message headers:

Received: from CY5PR18CA0016.namprd18.prod.outlook.com (2603:10b6:930:5::16)

by MW4PR18MB5184.namprd18.prod.outlook.com (2603:10b6:303:1b7::12) with
Microsoft SMTP Server (version=TLS1_2,
cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.7982.27; Thu, 26 Sep
2024 05:01:28 +0000

Received: from CY4PEPF0000E9D1.namprd03.prod.outlook.com

(2603:10b6:930:5:cafe::54) by CY5PR18CA0016.outlook.office365.com
(2603:10b6:930:5::16) with Microsoft SMTP Server (version=TLS1_2,
cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id 15.20.8005.17 via Frontend
Transport; Thu, 26 Sep 2024 05:01:27 +0000

Authentication-Results: spf=softfail (sender IP is 202.180.64.247)

smtp.mailfrom=xtra.co.nz; dkim=pass (signature was verified)
header.d=xtra.co.nz;dmarc=pass action=none header.from=xtra.co.nz;

Received-SPF: SoftFail (protection.outlook.com: domain of transitioning

xtra.co.nz discourages use of 202.180.64.247 as permitted sender)

Received: from mda-1.slingshot.co.nz (202.180.64.247) by

CY4PEPF0000E9D1.mail.protection.outlook.com (10.167.241.136) with Microsoft
SMTP Server (version=TLS1_2, cipher=TLS_ECDHE_RSA_WITH_AES_256_GCM_SHA384) id
15.20.8005.15 via Frontend Transport; Thu, 26 Sep 2024 05:01:27 +0000

X-IncomingTopHeaderMarker: OriginalChecksum:DB1FE006DE5E96A6CB1C51C2D72775AD0076153BEBCC1BDA65711D9E9A6537A9;UpperCasedChecksum:778EF9C4E589FF5ECCD72A8C27E3459E0E6D41342EEF1A70760B01A53E8BF679;SizeAsReceived:4099;Count:27 Received: from [10.253.37.119] (port=46199 helo=spamtitan-3.slingshot.co.nz) by mda-1.slingshot.co.nz with esmtp (Exim 4.90_1) (envelope-from <tony.perkins@xtra.co.nz>) id 1stgd4-0007OD-Dc for colin.selfe@slingshot.co.nz; Thu, 26 Sep 2024 17:01:26 +1200 Received: from localhost (localhost [127.0.0.1]) by spamtitan-3.slingshot.co.nz (Postfix) with ESMTP id 502359913BE for <colin.selfe@slingshot.co.nz>; Thu, 26 Sep 2024 17:02:19 +1200 (NZST) X-Virus-Scanned: by SpamTitan at slingshot.co.nz X-Spam-Flag: NO X-Spam-Score: -2.198 X-Spam-Level: X-Spam-Status: No, score=-2.198 tagged_above=-999 required=5.3 tests=[BAYES_00=-1.9, DKIM_SIGNED=0.1, DKIM_VALID=-0.1, DKIM_VALID_AU=-0.1, DKIM_VALID_EF=-0.1, FREEMAIL_FROM=0.001, RCVD_IN_VALIDITY_CERTIFIED_BLOCKED=0.001, RCVD_IN_VALIDITY_RPBL_BLOCKED=0.001, SPF_HELO_PASS=-0.001, SPF_PASS=-0.001, ST_P0F_Linux=-0.1, URIBL_BLOCKED=0.001] autolearn=ham autolearn_force=no Received: from spamtitan-3.slingshot.co.nz (localhost [127.0.0.1]) by spamtitan-3.slingshot.co.nz (Postfix) with ESMTP id AFC029913A5 for <colin.selfe@slingshot.co.nz>; Thu, 26 Sep 2024 17:02:07 +1200 (NZST) Authentication-Results-Original: spamtitan-3.slingshot.co.nz; dkim=pass

(1024-bit rsa key sha256) header.d=xtra.co.nz          header.i=@xtra.co.nz
header.b=T4OlzVWQ header.a=rsa-sha256          header.s=alpha x-bits=1024;
       spf=pass smtp.mailfrom=tony.perkins@xtra.co.nz
         smtp.helo=out2305.xtra.co.nz

Received-SPF: pass

       (xtra.co.nz: 210.55.143.52 is authorized to use 'tony.perkins@xtra.co.nz' in 'mfrom' identity (mechanism 'ip4:210.55.143.48/29' matched))
       receiver=spamtitan-3.slingshot.co.nz;
       identity=mailfrom;
       envelope-from="tony.perkins@xtra.co.nz";
       helo=out2305.xtra.co.nz;
       client-ip=210.55.143.52

Received: from out2305.xtra.co.nz (out2305.xtra.co.nz [210.55.143.52]) by spamtitan-3.slingshot.co.nz (Postfix) with ESMTPS id A225A9913AB for <colin.selfe@slingshot.co.nz>; Thu, 26 Sep 2024 17:02:07 +1200 (NZST) DKIM-Signature: v=1; a=rsa-sha256; c=relaxed/relaxed; d=xtra.co.nz; s=alpha; t=1727326874; bh=H78nCiYDtFwdgxiHc6OD0p8AlpIcxsbZIcjSHe2zddg=; h=Message-ID:Date:To:From:Subject; b=T4OlzVWQAbA91+M4Q7Wz9amCL40k60E+h3rzIHHdA9AUB1nJyj/779fmlfB9h55jF DV3I0p9zHK+Qpx2H+VdDjBm1U6t4OtKvBu55r0+/HLuHPIf5PmMwkUwEP4ikLOQSsf 1EUcZcB4Hexjl8bvT7nHB/1+SbaEennpjJ/vvQow= SMX-Results: classifications=clean;dmarc=none;spf=softfail SMX-S1C: gggruggvucftvghtrhhoucdtuddrgeeftddrvddtiedgledtucetufdoteggodetrfdotffvucfrrh hofhhilhgvmecuuffoigenuceurghilhhouhhtmecufedttdenucesvcftvggtihhpihgvnhhtshcu lddquddttddmnecujfgurhepkfffgggfvffhufgtgfesthejredttddvjeenucfhrhhomhepvfhonh ihucfrvghrkhhinhhsuceothhonhihrdhpvghrkhhinhhsseigthhrrgdrtghordhniieqnecuggft rfgrthhtvghrnhepheegueelleehudeiueegtdeigfegvdefvdfgheeujeeivedtjeehkeeivdehtd dunecukfhppedvvddvrdduheefrddvhedvrddukeenucevlhhushhtvghrufhiiigvpedtnecurfgr rhgrmhepihhnvghtpedvvddvrdduheefrddvhedvrddukedpmhgrihhlfhhrohhmpehtohhnhidrph gvrhhkihhnshesgihtrhgrrdgtohdrnhiipdhnsggprhgtphhtthhopedupdhrtghpthhtoheptgho lhhinhdrshgvlhhfvgesshhlihhnghhshhhothdrtghordhniidpmhhouggvpehsmhhtphhouhhtpd hsphhfpehsohhfthhfrghilhdphhgvlhhopegludelvddrudeikedruddrjeefngdpoffvtefjohhs thepmhhtrgdvfedtuddptehuthhhpghushgvrhepthhonhihrdhpvghrkhhinhhsseigthhrrgdrtg hordhniidprhgvvhfkrfepvddvvddqudehfedqvdehvddqudekqdhfihgsrhgvrdhsphgrrhhksggs rdgtohdrnhii SMX-S1V: clean SMX-S1S: -100 Received: from [222.153.252.18] by send.xtra.co.nz with ESMTP (using TLSv1.3 with cipher TLS_AES_256_GCM_SHA384 (256/256 bits)) id 66F4EA99-AF8304CF@mta2301.omr; Thu, 26 Sep 2024 05:01:14 +0000 Message-ID: <13898879-8cdf-4c48-8c41-d73b904b0218@xtra.co.nz> Date: Thu, 26 Sep 2024 17:01:14 +1200 MIME-Version: 1.0 User-Agent: Mozilla Thunderbird To: Colin Selfe <colin.selfe@slingshot.co.nz> Content-Language: en-NZ From: Tony Perkins <tony.perkins@xtra.co.nz> Subject: JPproductions Content-Type: text/plain; charset=UTF-8; format=flowed Content-Transfer-Encoding: 7bit X-IncomingHeaderCount: 27 Return-Path: tony.perkins@xtra.co.nz X-EOPAttributedMessage: 0 X-EOPTenantAttributedMessage: 84df9e7f-e9f6-40af-b435-aaaaaaaaaaaa:0 X-MS-PublicTrafficType: Email X-MS-TrafficTypeDiagnostic: CY4PEPF0000E9D1:EE_|MW4PR18MB5184:EE_ X-MS-Office365-Filtering-Correlation-Id: b990f7fa-306a-45fb-ecf3-08dcdde84742 X-MS-Exchange-EOPDirect: true X-Sender-IP: 202.180.64.247 X-SID-PRA: TONY.PERKINS@XTRA.CO.NZ X-SID-Result: PASS X-Microsoft-Antispam: BCL:0;ARA:1444111002|32000799015|461199028|1370799030|1380799030|1360799030|3412199025|440099028; X-Microsoft-Antispam-Message-Info: 2kKnXLplXHmjbfleeJ/bK1BAdohb7k3RZrkD0GaO7u8wESFqkG4fwKjlX6uyfHCaZnsqVO3BYPdLZL3mJRxCre+vhNmMStCGb9VFiwx09RfMMqOHrnXIrRxGOWEZroW+yVf83DDov9XR48k/GRw1s9/ewkNPL7Oq0dwn3iZOAYnCKk9BRf3eQcil8Nv57Gc5pnETDNteSqVa7/ZN4r4VkcrTbuSLKh8C/Aki7xli3+rbwlO64ZIjiGDR1j28FlNdR8oqjcark/6hpyxU3xnJmBSJ8IcPsZBwnxCB3x9gq6bVB4+KVvyMjM96qIeXTdhbtOU1pYWEuz3/49gpfih0RyGrlS8fshI6Ep3Ccyy9C8tPHdzDyeRLwDe6+izQ1oRNZfUMK+wXUHNLe9o5ljWS+15q2PVUynbMcXK3OWo1c3HkqBqqEqDncu/dL05BlWesHvNfT7/5dnYLLPJPfWUmGcoY7NfxcapjhgAvnLxmq3HEz7UornCtKJ643QmpBMOz2dk4h/xjRBWaoRGjCQL8oago5+GapirJNm1VVHgF6fkjguu5Tjw2QAGm1XRzWMUxQ0kvw5wSfGiixthUQoj3OIGpyWwyqnRqb7swBz64mWYQl0SeOKE7JSGYRZjoo72welRQvGZQahqDWOi+I2jJ7WP7mzNG0CJNk6PG29EwC8FBhG5w9ywMm5la01BvazaJz9+AHQ4mW09UXsYf3cXxPseTiivUDkgS/NauxASoFM7NGmE7BG41ypkIoQ8XuX2CZqkf0xtkK3KudT/j030HAOs51m7xY7oE5GrEuBtj+iLzKRjAcSrQtkbG6DjyTLGljOhAFkmvBvmURvrlvSFE8g==

Reporting-MTA: dns;MW4PR18MB5184.namprd18.prod.outlook.com Received-From-MTA: dns;mda-1.slingshot.co.nz Arrival-Date: Thu, 26 Sep 2024 05:01:28 +0000

Final-Recipient: rfc822;colinandchris@outlook.com Action: failed Status: 5.5.0 Diagnostic-Code: smtp;550 5.5.0 Requested action not taken: mailbox unavailable.

Thunderbird gobbles up too much of my SSD space!

How can I prevent this from happening?

I'm using Thunderbird 128.2.3esr (64-bit) Safari browser Version 18.0 (19619.1.26.111.10, 19619) Macbook Air M2 15" running OS 14.7

See attached screenshot

A quick message to say !! THANK YOU !!

I have been the victim of 30 years of human rights violations, some of the worst in UK history, only to find the graphic content of harm in the attachments showing proof of GBH, and irreversible injury sent to ASA, Charity Commission, and Amnesty International, were "returned undeliverable" on my Outlook email account, 6 X in a row, presumably by those profiting from the awful harms I am exposing and reporting.

I tried opening a Yahoo account, same problem. Then Gmail, same problem.

Thunderbird sent it fine! No "undeliverable" message.

This means those at the Charity Commission and the ASA will get to see the content and something will finally be done about some of our most serious human rights violations.

Only thanks to Mozilla and Thunderbird.

I wish I could express more clearly how important this is and how much this means to the unfortunate victims of these abuses.

THANK YOU !!!

Hello Experts,

I am a long-time user and fan of Thunderbird (various platforms).

I am currently using Thunderbird v 128.2.3esr (64-bit) on a 2018 Mac Mini (specs below). I do not use the Calendar or Chat features of TB. TB is configured to use the "macOS Address Book" (i.e. Mac's "Contacts") - and this is a critical feature for me.

I recently upgraded from MacOS v12.7.6 (Monterey) to MacOS v14.7 (Sonoma).

Now there is a significant delay of at least 10 seconds (sometimes accompanied with the dreaded spinning beach ball) upon starting TB. The sequence is like this:

1) Start TB 2) Primary Password Required dialogue box appears instantly 3) After entering the password and hitting return to sign in TB "Home" window appears but is blank 4) After a 10 second delay (sometimes with the beach ball appearing) the TB window completely opens, populated in the normal manner. 5) TB then seems to operate normally.

I have read article "https://support.mozilla.org/bm/questions/1421395". I can confirm that if I "disable Thunderbird's access to Mac Contacts in Mac Settings" then there is no delay noted in step 4 above. So it seems the delay does result from having TB access the macOS Address Book.

BUT it is a critically important feature for TB to utilize the macOS Address Book (Contacts).

I sync Mac Contacts across devices via iCloud, so TB will have access to the current collection of addresses, and I need only use one application to maintain my contacts.

I can live with the startup delay, disappointing though it is, because I find TB to be the best email application.

I do not know if the same issue occurs with the recently released macOS 15.x (Sequoia) - and I'm not ready or willing to upgrade to that version for a multitude of reasons.

It would be nice if the wonderful developers would investigate and resolve this delay issue.

Comments, tricks, and pointers most welcome.

Thanks.

PS: Does anyone know if this issue persists with macOS 15.x (Sequoia)?

Mac Mini specs: 3.2 GHz 6-Core Intel Core i7 Intel UHD Graphics 630 1536 MB 32 GB 2667 MHz DDR4

unable to login to my microsoft outlook accout as from today

I keep getting an error message that pasord is incorrect which it is not because i can login direct to the account

For the past few days I have intermittently had a problem sending email. I get email from Spectrum, my ISP. When I try to send I get this message: Sending of the message failed. An error occurred while sending mail: Outgoing server (SMTP) error. The server responded: p-impout007.msg.pkvw.co.charter.net cmsmtp 173.211.127.45 blocked. Please see https://www.spectrum.net/support/internet/understanding-email-error-codes for more information. AUP#Out-1130.

When I go to the indicated website and look up error 1130, this is what I get: The IP address you’re trying to connect from has an issue with the Domain Name System. Spectrum requires a full circle DNS for emails to be allowed through. Verify the IP you’re connecting from, and check the IP address to ensure a reverse DNS entry exists for the IP. If the IP address is a Spectrum-provided email address, contact us.

Note my email address is not Spectrum provided.

Microsoft outlook warned that I will no longer be able to use thunderbird after Sept 16th unless I use Oauth. I've tried changing settings to allow Oauth, but it's not listed as an option fot outgoing mail. Is this because I'm running windows 7? Is there any way around this, I want to keep win 7?

Thanks...

I had an update by Thunderbird a couple of days ago but since then I cannot sent outgoing emails. I keep getting messages asking me to check the settings and it is set on SSL/TLS with password Authentication all passwords are correct but it will not accept any of my three BT emails can anyone please help. please feel free to ask me for any further information should it help my case. thanks