Rechercher dans l’assistance

Évitez les escroqueries à l’assistance. Nous ne vous demanderons jamais d’appeler ou d’envoyer un SMS à un numéro de téléphone ou de partager des informations personnelles. Veuillez signaler toute activité suspecte en utilisant l’option « Signaler un abus ».

En savoir plus

Sending Emails from Thunderbird to Gmail

  • 1 réponse
  • 0 a ce problème
  • 1 vue
  • Dernière réponse par christ1

more options

Greetings. I am having trouble sending email from my account which is through Thunderbird to those individuals who have gmail accounts. Please advise. Thanks you.

Here is an example of the error message:

The original message was received at Thu, 6 Jul 2023 11:09:51 -0400 from 108-204-192-198.lightspeed.mmphtn.sbcglobal.net [108.204.192.198]

  ----- The following addresses had permanent fatal errors -----

<mattmckeegan25444@gmail.com>

   (reason: 550-5.7.26 This mail is unauthenticated, which poses a security risk to the)
  ----- Transcript of session follows -----

... while talking to gmail-smtp-in.l.google.com.: >>> DATA <<< 550-5.7.26 This mail is unauthenticated, which poses a security risk to the <<< 550-5.7.26 sender and Gmail users, and has been blocked. The sender must <<< 550-5.7.26 authenticate with at least one of SPF or DKIM. For this message, <<< 550-5.7.26 DKIM checks did not pass and SPF check for [mckeeganassociates.com] <<< 550-5.7.26 did not pass with ip: [69.156.243.30]. The sender should visit <<< 550-5.7.26 https://support.google.com/mail/answer/81126#authentication for <<< 550 5.7.26 instructions on setting up authentication. 70-20020a1f1749000000b0047161e5bb9csi152971vkx.43 - gsmtp 554 5.0.0 Service unavailable


Reporting-MTA: dns; mail290c9.megamailservers.com Received-From-MTA: DNS; 108-204-192-198.lightspeed.mmphtn.sbcglobal.net Arrival-Date: Thu, 6 Jul 2023 11:09:51 -0400

Final-Recipient: RFC822; mattmckeegan25444@gmail.com Action: failed Status: 5.7.26 Remote-MTA: DNS; gmail-smtp-in.l.google.com Diagnostic-Code: @gmail.com; 550-5.7.26 This mail is unauthenticated, which poses a security risk to the Last-Attempt-Date: Thu, 6 Jul 2023 11:09:58 -0400


X-POP-User: matt@mckeeganassociates.com Feedback-ID:matt@mckeeganas Authentication-Results: MTA-69.156.243.30; dkim=none; spf=none (MTA-69.156.243.30: domain of matt@mckeeganassociates.com has no SPF policy when checking 108.204.192.198) smtp.mailfrom=matt@mckeeganassociates.com; dmarc=none X-Envelope-From: matt@mckeeganassociates.com Return-Path: <matt@mckeeganassociates.com> Received: from [192.168.1.80] (108-204-192-198.lightspeed.mmphtn.sbcglobal.net [108.204.192.198]) by mail290c9.megamailservers.com (8.14.9/8.13.1) with ESMTP id 366F9lYW022129 for <mattmckeegan25444@gmail.com>; Thu, 6 Jul 2023 11:09:51 -0400 Content-Type: multipart/alternative;

boundary="------------2AMDNET0HgJUeo3qv9elOmlc"

Message-ID: <0641493e-e69a-c9cd-868d-2edd1e138bf1@mckeeganassociates.com> Date: Thu, 6 Jul 2023 10:09:48 -0500 MIME-Version: 1.0 User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64; rv:102.0) Gecko/20100101

Thunderbird/102.12.0

Subject: Fwd: Survey - Lone Oak References: <CAKiSXJU0pAC8HoEHWPtj+OkDJ1xA2Tgee1QaEJP4-a4r5bNN0w@mail.gmail.com> Content-Language: en-US To: mattmckeegan25444@gmail.com From: Matt McKeegan <matt@mckeeganassociates.com> Organization: McKeegan Associates In-Reply-To: <CAKiSXJU0pAC8HoEHWPtj+OkDJ1xA2Tgee1QaEJP4-a4r5bNN0w@mail.gmail.com> X-Forwarded-Message-Id: <CAKiSXJU0pAC8HoEHWPtj+OkDJ1xA2Tgee1QaEJP4-a4r5bNN0w@mail.gmail.com> X-VADE-SPAMSTATE: clean X-VADE-SPAMSCORE: 0 X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrudelgdekhecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffuvffqrffktedpqfgfvfdpgffpggdqvedvnecuuegrihhlohhuthemuceftddunecunecujfgurheptgfkffggfgfufhfvhfhojgesrgdtreertdefjeenucfhrhhomhepofgrthhtucfotgfmvggvghgrnhcuoehmrghtthesmhgtkhgvvghgrghnrghsshhotghirghtvghsrdgtohhmqeenucggtffrrghtthgvrhhnpeetveetffejleegtdeguddvgeffffevieelkeejgeefgfetkefgudeiudfftdehgfenucfkphepuddtkedrvddtgedrudelvddrudelkeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpedutdekrddvtdegrdduledvrdduleekpdhhvghloheplgduledvrdduieekrddurdektdgnpdhmrghilhhfrhhomhepmhgrthhtsehmtghkvggvghgrnhgrshhsohgtihgrthgvshdrtghomhdpnhgspghrtghpthhtohepuddprhgtphhtthhopehmrghtthhmtghkvggvghgrnhdvheeggeegsehgmhgrihhlrdgtohhm X-CTCH-RefID: 0641493e-e69a-c9cd-868d-2edd1e138bf1@mckeeganassociates.com X-CTCH-VOD: Unknown X-CTCH-Spam: mc_UNKNOWN X-CTCH-Score: 0.000 X-CTCH-Rules: X-CTCH-Flags: 0 X-CTCH-ScoreCust: 0.000 X-Rspamd-Status: No, score=5.40 X-Rspamd-Result: default: False [5.40 / 6.00]; HFILTER_HELO_BADIP(4.50)[192.168.1.80,1]; AUTH_NA(1.00)[]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; R_SPF_NA(0.00)[no SPF record]; FREEMAIL_TO(0.00)[gmail.com]; NEURAL_SPAM(0.00)[0.308]; RCVD_COUNT_ZERO(0.00)[0]; R_DKIM_NA(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; ARC_NA(0.00)[]; HAS_ORG_HEADER(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; TO_MATCH_ENVRCPT_ALL(0.00)[]; FROM_HAS_DN(0.00)[]; ASN(0.00)[asn:7018, ipnet:108.192.0.0/10, country:US]; FREEMAIL_ENVRCPT(0.00)[gmail.com]; DMARC_NA(0.00)[mckeeganassociates.com]; TO_DN_NONE(0.00)[]; MID_RHS_MATCH_FROM(0.00)[] X-Origin-Country: US

Greetings. I am having trouble sending email from my account which is through Thunderbird to those individuals who have gmail accounts. Please advise. Thanks you. Here is an example of the error message: The original message was received at Thu, 6 Jul 2023 11:09:51 -0400 from 108-204-192-198.lightspeed.mmphtn.sbcglobal.net [108.204.192.198] ----- The following addresses had permanent fatal errors ----- <mattmckeegan25444@gmail.com> (reason: 550-5.7.26 This mail is unauthenticated, which poses a security risk to the) ----- Transcript of session follows ----- ... while talking to gmail-smtp-in.l.google.com.: >>> DATA <<< 550-5.7.26 This mail is unauthenticated, which poses a security risk to the <<< 550-5.7.26 sender and Gmail users, and has been blocked. The sender must <<< 550-5.7.26 authenticate with at least one of SPF or DKIM. For this message, <<< 550-5.7.26 DKIM checks did not pass and SPF check for [mckeeganassociates.com] <<< 550-5.7.26 did not pass with ip: [69.156.243.30]. The sender should visit <<< 550-5.7.26 https://support.google.com/mail/answer/81126#authentication for <<< 550 5.7.26 instructions on setting up authentication. 70-20020a1f1749000000b0047161e5bb9csi152971vkx.43 - gsmtp 554 5.0.0 Service unavailable Reporting-MTA: dns; mail290c9.megamailservers.com Received-From-MTA: DNS; 108-204-192-198.lightspeed.mmphtn.sbcglobal.net Arrival-Date: Thu, 6 Jul 2023 11:09:51 -0400 Final-Recipient: RFC822; mattmckeegan25444@gmail.com Action: failed Status: 5.7.26 Remote-MTA: DNS; gmail-smtp-in.l.google.com Diagnostic-Code: @gmail.com; 550-5.7.26 This mail is unauthenticated, which poses a security risk to the Last-Attempt-Date: Thu, 6 Jul 2023 11:09:58 -0400 X-POP-User: matt@mckeeganassociates.com Feedback-ID:matt@mckeeganas Authentication-Results: MTA-69.156.243.30; dkim=none; spf=none (MTA-69.156.243.30: domain of matt@mckeeganassociates.com has no SPF policy when checking 108.204.192.198) smtp.mailfrom=matt@mckeeganassociates.com; dmarc=none X-Envelope-From: matt@mckeeganassociates.com Return-Path: <matt@mckeeganassociates.com> Received: from [192.168.1.80] (108-204-192-198.lightspeed.mmphtn.sbcglobal.net [108.204.192.198]) by mail290c9.megamailservers.com (8.14.9/8.13.1) with ESMTP id 366F9lYW022129 for <mattmckeegan25444@gmail.com>; Thu, 6 Jul 2023 11:09:51 -0400 Content-Type: multipart/alternative; boundary="------------2AMDNET0HgJUeo3qv9elOmlc" Message-ID: <0641493e-e69a-c9cd-868d-2edd1e138bf1@mckeeganassociates.com> Date: Thu, 6 Jul 2023 10:09:48 -0500 MIME-Version: 1.0 User-Agent: Mozilla/5.0 (Windows NT 10.0; Win64; x64; rv:102.0) Gecko/20100101 Thunderbird/102.12.0 Subject: Fwd: Survey - Lone Oak References: <CAKiSXJU0pAC8HoEHWPtj+OkDJ1xA2Tgee1QaEJP4-a4r5bNN0w@mail.gmail.com> Content-Language: en-US To: mattmckeegan25444@gmail.com From: Matt McKeegan <matt@mckeeganassociates.com> Organization: McKeegan Associates In-Reply-To: <CAKiSXJU0pAC8HoEHWPtj+OkDJ1xA2Tgee1QaEJP4-a4r5bNN0w@mail.gmail.com> X-Forwarded-Message-Id: <CAKiSXJU0pAC8HoEHWPtj+OkDJ1xA2Tgee1QaEJP4-a4r5bNN0w@mail.gmail.com> X-VADE-SPAMSTATE: clean X-VADE-SPAMSCORE: 0 X-VADE-SPAMCAUSE: gggruggvucftvghtrhhoucdtuddrgedviedrudelgdekhecutefuodetggdotefrodftvfcurfhrohhfihhlvgemucfjqffuvffqrffktedpqfgfvfdpgffpggdqvedvnecuuegrihhlohhuthemuceftddunecunecujfgurheptgfkffggfgfufhfvhfhojgesrgdtreertdefjeenucfhrhhomhepofgrthhtucfotgfmvggvghgrnhcuoehmrghtthesmhgtkhgvvghgrghnrghsshhotghirghtvghsrdgtohhmqeenucggtffrrghtthgvrhhnpeetveetffejleegtdeguddvgeffffevieelkeejgeefgfetkefgudeiudfftdehgfenucfkphepuddtkedrvddtgedrudelvddrudelkeenucevlhhushhtvghrufhiiigvpedtnecurfgrrhgrmhepihhnvghtpedutdekrddvtdegrdduledvrdduleekpdhhvghloheplgduledvrdduieekrddurdektdgnpdhmrghilhhfrhhomhepmhgrthhtsehmtghkvggvghgrnhgrshhsohgtihgrthgvshdrtghomhdpnhgspghrtghpthhtohepuddprhgtphhtthhopehmrghtthhmtghkvggvghgrnhdvheeggeegsehgmhgrihhlrdgtohhm X-CTCH-RefID: 0641493e-e69a-c9cd-868d-2edd1e138bf1@mckeeganassociates.com X-CTCH-VOD: Unknown X-CTCH-Spam: mc_UNKNOWN X-CTCH-Score: 0.000 X-CTCH-Rules: X-CTCH-Flags: 0 X-CTCH-ScoreCust: 0.000 X-Rspamd-Status: No, score=5.40 X-Rspamd-Result: default: False [5.40 / 6.00]; HFILTER_HELO_BADIP(4.50)[192.168.1.80,1]; AUTH_NA(1.00)[]; MIME_GOOD(-0.10)[multipart/alternative,text/plain]; R_SPF_NA(0.00)[no SPF record]; FREEMAIL_TO(0.00)[gmail.com]; NEURAL_SPAM(0.00)[0.308]; RCVD_COUNT_ZERO(0.00)[0]; R_DKIM_NA(0.00)[]; FROM_EQ_ENVFROM(0.00)[]; MIME_TRACE(0.00)[0:+,1:+,2:~]; ARC_NA(0.00)[]; HAS_ORG_HEADER(0.00)[]; RCPT_COUNT_ONE(0.00)[1]; TO_MATCH_ENVRCPT_ALL(0.00)[]; FROM_HAS_DN(0.00)[]; ASN(0.00)[asn:7018, ipnet:108.192.0.0/10, country:US]; FREEMAIL_ENVRCPT(0.00)[gmail.com]; DMARC_NA(0.00)[mckeeganassociates.com]; TO_DN_NONE(0.00)[]; MID_RHS_MATCH_FROM(0.00)[] X-Origin-Country: US

Toutes les réponses (1)

more options

Your email provider neither supports SPF nor DKIM. Talk to your email provider, and pass on the link with the instructions Google provided in the error message.